PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 294aa    MW: 31704.5 Da    PI: 10.3088
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08575genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-153579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE++++v+a + +G + Wk+I + +  ++t  q++s+ qk+
         EMT08575 35 RERWTDEEHQRFVHALHIFGRD-WKSIEALVA-TKTSVQIRSHAQKH 79
                     78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-162985IPR009057Homeodomain-like
PROSITE profilePS5129418.4873084IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-83385IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-153482IPR006447Myb domain, plants
SMARTSM007177.5E-113482IPR001005SANT/Myb domain
PfamPF002491.6E-123579IPR001005SANT/Myb domain
CDDcd001674.61E-93780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MATMVRGARM PAAARSSASG RNKKLRKPYT ITRPRERWTD EEHQRFVHAL HIFGRDWKSI  60
EALVATKTSV QIRSHAQKHF LKAQKLGLGS CLPPPLHPRR AAALRQQPPA HPDADMLAPS  120
MDWACAAPGS RWPDLDAPGA GECPSADALA LHLQDETVQL PLSPHDPRFA LVYRFVGDVF  180
AADAAVPVDA QLQRLQLQGV DPVVVDTISG GGAVREVLVA LDSSGVRSGR VMIVGEHFSS  240
LKSHPPSLLE HQGGATQAAV LADVGPTHKA RVAALAVVKI HRFSVFILVL LING
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3595770.0AK359577.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1099F17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566512.23e-74PREDICTED: protein REVEILLE 6-like
TrEMBLM8B4N90.0M8B4N9_AEGTA; Myb-like protein G
STRINGMLOC_5590.31e-116(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.16e-27MYB_related family protein